PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG345300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 360aa    MW: 38804.9 Da    PI: 6.9294
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG345300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.3e-5261341128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgk
  Pavir.9KG345300.1.p   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATATGYWKATGK 94 
                          79****************************.99**************95334445667******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+++ + +g + gl+ktLvfy+grap ge+tdWvmheyrl
  Pavir.9KG345300.1.p  95 DRRIACDGGGVYGLRKTLVFYRGRAPGGERTDWVMHEYRL 134
                          **************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-603156IPR003441NAC domain
PROSITE profilePS5100557.3526157IPR003441NAC domain
PfamPF023655.5E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATATGYWK ATGKDRRIAC DGGGVYGLRK TLVFYRGRAP  120
GGERTDWVMH EYRLCQDLAH GACNFIGAYA LCRVIKRHEA GLLQGEPAAR AKGASNARGQ  180
MSKVSSTSSL VSSEQQLSAL TTTNSSPPPP PPTLDMSSRG MCAMAAESGS TFQSPLAYGG  240
DATATATTAG LPSSPLPPPL FVPGGHSPPH GTFFVGADLP AESPSHAPPP LFGGGDMGML  300
GAADHELLRW DSFAYPSTFS NGAEMWNAAA SPMLCRQASD GGVDDLALLF FSEDSRIVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50116012168NO APICAL MERISTEM PROTEIN
1ut4_B1e-50116012168NO APICAL MERISTEM PROTEIN
1ut7_A1e-50116012168NO APICAL MERISTEM PROTEIN
1ut7_B1e-50116012168NO APICAL MERISTEM PROTEIN
4dul_A1e-50116012168NAC domain-containing protein 19
4dul_B1e-50116012168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-150PREDICTED: NAC domain-containing protein 67-like
SwissprotA4VCM02e-70NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A096R9061e-150A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P011e-150(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.16e-83NAC domain containing protein 71